P Palthera
Growth Factors

Thymosin Beta-4

Tβ4 / TMSB4X gene product

Thymosin Beta-4 (Tβ4) is a 43- -binding peptide expressed in many human tissues. Published research spans cell-biology , rodent models, human-organoid work, and a small number of early-phase clinical studies (e.g., in ophthalmology and cardiovascular research).

Add to comparison Subscribe
Abstract reference visual for Growth Factors.
Growth Factors
Classification
Naturally occurring actin-binding peptide
Research stage
Cell biology, rodent, and early-phase clinical literature
Sequence
43-amino-acid peptide (SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES)
Molecular weight
Approx. 4963 Da

Snapshot

Key takeaways

A three-bullet snapshot before reading the full dossier.

  1. 01

    Naturally occurring 43- -binding peptide encoded by TMSB4X.

  2. 02

    Published research spans cell, rodent, human-organoid, and limited early-phase clinical literature.

  3. 03

    Mechanistic interest focuses on sequestration, migration, and tissue remodelling.

Dossier overview

4

research areas

3

references

3

handling notes

01

Mechanism of action

Tβ4 is a primary intracellular G- sequestering peptide, and research literature also describes extracellular roles in cellular migration, ROCK1 modulation, and tissue-remodelling pathways in cardiac, neural, and developmental models.

02

Research applications

  • cytoskeleton studies
  • and developmental biology research
  • Cardiac remodelling models
  • Neurodevelopmental and organoid research

03

Study references

Each profile cites a minimum of two peer-reviewed sources, with model type and reported sample size where the source provides it. Findings are model-specific and must not be extrapolated to therapeutic use.

Thymosin β4 and β10 Expression in Human Organs during Development: A Review

2024

Faa G et al. · Cells

Model
Narrative review (human tissue expression literature)
Sample
N/A (review)

Reviewed proteomic and immunohistochemical studies of Tβ4 and Tβ10 expression across human organs from fetal development through postnatal stages.

PMID 38994967 DOI 10.3390/cells13131115

Thymosin Beta-4 Modulates Cardiac Remodeling by Regulating ROCK1 Expression in Adult Mammals

2025

Maar K et al. · International Journal of Molecular Sciences

Model
In vivo — C57BL/6J male mice (LAD coronary ligation); in vitro human cardiac cells
Sample
~48–60 mice across sub-experiments (microarray n=4/group/timepoint; PCR n=4; Western blot n=3; IHC n=3); in vitro n=3 per cell type

Tβ4 treatment was associated with increased miR-139-5p, modulated ROCK1 protein levels, and reduced fibroblast transformation in infarcted heart tissue.

PMID 40362372 DOI 10.3390/ijms26094210

Thymosin beta 4 as an Alzheimer disease intervention target identified using human brain organoids

2025

Zeng PM et al. · Stem Cell Reports

Model
In vitro — human iPSC cerebral organoids (3 iPSC lines: 2 familial AD + 1 control); in vivo — 5xFAD transgenic mice
Sample
≥13 organoids per group across 4 independent experiments; AAV-GFP n=9 mice, AAV-TMSB4X n=7 mice; electrophysiology ≥10 neurons from ≥3 mice per group

Tβ4 was associated with rescue of neuronal maturation deficits and reduced amyloid-β formation in the organoid and transgenic-mouse systems used.

PMID 40816274 DOI 10.1016/j.stemcr.2025.102554

Evidence caveats

  • Although Tβ4 is endogenously expressed in humans, synthetic Tβ4 products marketed under names such as 'TB-500' are not equivalent to approved therapeutics.
  • Findings from organoid and rodent models do not establish clinical efficacy.

04

Storage and handling

Store in clearly labelled research inventory under appropriate temperature and contamination-control procedures.

  • Use clear labelling when comparing native peptide and material.
  • Keep study notes separate for source material and synthetic material.
  • Record storage condition and sample preparation history.

05

Related reading

education

Operational

Handling

Storage, Stability, and Research Inventory Controls

A practical overview of the storage and documentation variables commonly considered in peptide research inventories.

6 min

Read article

research

Research summary

Handling

Peptide Stability in Laboratory Handling

A formal summary of stability considerations used when evaluating peptide compounds in laboratory settings.

7 min

Read article
View full Growth Factors